PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta012867
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family LBD
Protein Properties Length: 126aa    MW: 13996 Da    PI: 6.0776
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-27489PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26080.82.2e-25393999
     DUF260  9 rrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99
               +++C ++ ++   f +++ +kfa++h++FGa nv+kl+++lp+++r da++s+vyeA ar++dP  G++g+i++lq+q++ l+ +++++++
  Pta012867  3 QKECLANSTMLYRFLSNDLHKFAILHQVFGACNVIKLIRDLPPDQRIDAINSMVYEASARLQDPALGCTGIIQQLQRQISALECQISTTQA 93
               789*999999999************************************************************************998875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089117.002195IPR004883Lateral organ boundaries, LOB
PROSITE profilePS512575134No hitNo description
PfamPF031953.4E-24392IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 126 aa     Download sequence    Send to blast
MEQKECLANS TMLYRFLSND LHKFAILHQV FGACNVIKLI RDLPPDQRID AINSMVYEAS  60
ARLQDPALGC TGIIQQLQRQ ISALECQIST TQAIIQKIRS QQEQLLASIP GFGTAGEEDT  120
TSIGHH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA9P1U35e-58A9P1U3_PICSI; Putative uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.17e-29LBD family protein